PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10006727m
Common NameCARUB_v10006727mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 245aa    MW: 27560.7 Da    PI: 9.9144
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10006727mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.74.9e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT +Ed +l+ +vk++G+g+W + a++ g++R++ +c++rw +yl
  Carubv10006727m 14 KGEWTDDEDRKLAAYVKEHGSGHWGSLAKKAGLKRCGRSCRLRWMNYL 61
                     799*******************************************97 PP

2Myb_DNA-binding46.49.1e-1567110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++++ E++++ + +++ G++ W+ Ia++++ +Rt+ ++k++w++
  Carubv10006727m  67 RGKFSPHEEQQIFKFHALIGNR-WAVIAKHIP-NRTDHDIKNYWNS 110
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.584961IPR017930Myb domain
SuperFamilySSF466893.67E-2811108IPR009057Homeodomain-like
SMARTSM007176.0E-141363IPR001005SANT/Myb domain
PfamPF002492.6E-151461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-221568IPR009057Homeodomain-like
CDDcd001671.67E-101661No hitNo description
PROSITE profilePS5129422.26362116IPR017930Myb domain
SMARTSM007172.0E-1466114IPR001005SANT/Myb domain
PfamPF002499.8E-1467110IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.4E-2469116IPR009057Homeodomain-like
CDDcd001674.61E-969112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 245 aa     Download sequence    Send to blast
MGRMTWFDDE GMKKGEWTDD EDRKLAAYVK EHGSGHWGSL AKKAGLKRCG RSCRLRWMNY  60
LSPDIKRGKF SPHEEQQIFK FHALIGNRWA VIAKHIPNRT DHDIKNYWNS RLKKRLAKER  120
IKPATTHEPA AIITVEATST STTSPSPTLS TTSSSFCPTG SARLLNKLAT GIASRKYRLD  180
KIKMVILQPR KASGKEKMLI TMEEEDLIAC FMDIDERLMS TTPFCEGSTA TTTSLVAFDD  240
CSIV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-26141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006285337.10.0hypothetical protein CARUB_v10006727mg
SwissprotO643997e-54MYB34_ARATH; Transcription factor MYB34
TrEMBLR0H0U20.0R0H0U2_9BRAS; Uncharacterized protein
STRINGfgenesh2_kg.2__1707__AT1G74430.13e-94(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74430.11e-90myb domain protein 95